Research updates from Luvaminos
Subscribe for catalog updates, new research compounds, and quality documentation releases.
For researchers and labs. No spam — unsubscribe anytime.
Research updates from Luvaminos
Subscribe for catalog updates, new research compounds, and quality documentation releases.
For researchers and labs. No spam — unsubscribe anytime.
Growth Factor
An IGFBP-resistant recombinant analogue of insulin-like growth factor-1 studied in receptor-signaling, structural, and serum-free cell-culture research.
Reviewed by Dr. James Whitfield, PharmD · Published · Last reviewed · For research use only.
Type
Recombinant single-chain polypeptide analogue of human IGF-1 (83 residues)
Molecular formula
C400H625N111O115S9
Molecular weight
~9,117 g/mol (~9.1 kDa)
CAS number
946870-92-4
Amino acids
83
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Modification
13-residue hydrophobic N-terminal extension (MFPAMPLSSLFVN) joined to the IGF-1 core through a Val-Asn link, plus a Glu3->Arg3 substitution; three intramolecular disulfide bridges as in native IGF-1.
A single-chain polypeptide analogue whose structural binding partner is a receptor tyrosine kinase of the insulin-receptor structural family. The native IGF-1 core retains the three-helix fold and three disulfide bridges of the IGF/insulin family, leaving the receptor-binding region structurally intact. The Glu3->Arg substitution and the hydrophobic 13-residue N-terminal extension alter the charge and steric environment at the N-terminus, lowering affinity for the IGF-binding proteins (IGFBP-1 through -6) that otherwise sequester native IGF-1, while preserving the structural binding determinants of the native core.
Lyophilized
20°C long term
protect from moisture.
Disulfide-bonded protein; sensitive to repeated freeze-thaw and oxidation.
Reviews
Werner H. (2023). Int J Mol Sci
Khan MZ, Zugaza JL, Torres Aleman I. (2024). J Biol Chem
Lin SL, Lin CY, Lee W, Teng CF, Shyu WC, Jeng LB. (2022). Int J Mol Sci
Primary research
White A, Stremming J, Wesolowski SR, Al-Juboori SI, Dobrinskikh E, Limesand SW, Brown LD, Rozance PJ. (2025). Am J Physiol Endocrinol Metab
Mongongu C, Coudoré F, Domergue V, Ericsson M, Buisson C, Marchand A. (2021). Drug Test Anal
Qian Y, Lewis AM, Sidnam SM, et al. (2017). Process Biochem
Dahodwala H, Nowey M, Mitina T, Sharfstein ST. (2012). Cytotechnology
Voorhamme D, Yandell CA. (2006). Mol Biotechnol
Bieberich E. (2005). Anal Biochem
Morris AE, Schmid J. (2000). Biotechnol Prog
Laajoki LG, Francis GL, Wallace JC, Carver JA, Keniry MA. (2000). J Biol Chem
Conlon MA, Tomas FM, Owens PC, Wallace JC, Howarth GS, Ballard FJ. (1995). J Endocrinol
Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ. (1992). Biochem J
Francis GL, Ross M, Ballard FJ, Milner SJ, Senn C, McNeil KA, Wallace JC, King R, Wells JR. (1992). J Mol Endocrinol
King R, Wells JR, Krieg P, Snoswell M, Brazier J, Bagley CJ, Wallace JC, Ballard FJ, Ross M, Francis GL. (1992). J Mol Endocrinol
Laajoki LG, Le Breton E, Shooter GK, Wallace JC, Francis GL, Carver JA, Keniry MA. (1997). FEBS Lett
Prelle K, Stojkovic M, Boxhammer K, Motlik J, Ewald D, Arnold GJ, Wolf E. (2001). Endocrinology
Gettmann J, Timmermann C, Becker J, et al. (2013). BMC Proc
Li J, Choi E, Yu H, Bai XC. (2019). Nat Commun
Stremming J, Heard S, White A, Chang EI, Shaw SC, Wesolowski SR, Jonker SS, Rozance PJ, Brown LD. (2021). Am J Physiol Endocrinol Metab
White A, Stremming J, Boehmer BH, Chang EI, Jonker SS, Wesolowski SR, Brown LD, Rozance PJ. (2021). Am J Physiol Endocrinol Metab
White A, Stremming J, Brown LD, Rozance PJ. (2023). J Dev Orig Health Dis
Also known as: Long R3 IGF-1, Long [Arg3] IGF-1
Research Use Only
These products are intended for research purposes only and are not for human consumption. Not FDA approved. Not intended to diagnose, treat, cure, or prevent any disease.
| Compound | Type | Molecular weight | CAS number |
|---|---|---|---|
| IGF-1 LR3This page | Recombinant single-chain polypeptide analogue of human IGF-1 (83 residues) | ~9,117 g/mol (~9.1 kDa) | 946870-92-4 |
| MGF | Synthetic peptide (IGF-1Ec C-terminal E-domain, 24 residues) | ~2,868 g/mol | — |
| P21 | Synthetic peptide (modified neurotrophic fragment) | 578.3 g/mol | — |
Comparison of laboratory reference specifications only. For research use only; not a therapeutic comparison.
Quality & methods