

Research updates from Luvaminos
Subscribe for catalog updates, new research compounds, and quality documentation releases.
For researchers and labs. No spam — unsubscribe anytime.
Signaling
The human cathelicidin host-defense peptide, investigated in innate-immunity and cell-signaling research.
Reviewed by Dr. James Whitfield, PharmD · Published · Last reviewed · For research use only.
Type
Host-defense peptide (37-residue cathelicidin fragment)
Molecular formula
C205H340N60O53
Molecular weight
4,493.3 g/mol
CAS number
154947-66-7
Amino acids
37
Sequence
[LL-37, 37 aa]
Modification
C-terminal antimicrobial peptide of hCAP-18 (CAMP gene product); the cathelin precursor is proteolytically processed to release the 37-residue peptide. Free termini; commonly supplied as an acetate or TFA salt.
The single human cathelicidin, derived from the C-terminus of the hCAP-18 precursor (CAMP gene). Research literature characterizes it as a cationic, amphipathic alpha-helix that associates with anionic microbial membranes and lipopolysaccharide (LPS); additional reported interactions in the literature include cell-surface G-protein-coupled and purinergic receptor classes and an intracellular binding partner (GAPDH) described in monocytes.
Lyophilized
20°C
protect from light and moisture; desiccated, ~24 months.
Cationic amphipathic peptide; activity is sensitive to ionic strength and serum components. Protect from light and moisture; aliquot to avoid freeze-thaw.
Reviews
Vandamme D, et al. (2012). Cell Immunol
Bucki R, et al. (2010). Arch Immunol Ther Exp (Warsz)
Durr UHN, Sudheendra US, Ramamoorthy A. (2006). Biochim Biophys Acta
Primary research
Sancho-Vaello E, et al. (2020). Sci Rep
Coorens M, et al. (2011). PLoS One
Mookherjee N, et al. (2009). J Immunol
Overhage J, et al. (2008). Infect Immun
Wang G. (2008). J Biol Chem
Porcelli F, et al. (2008). Biochemistry
Sevcsik E, et al. (2007). Biochim Biophys Acta
Oren Z, et al. (1999). Biochem J
Johansson J, et al. (1998). J Biol Chem
Rosenfeld Y, Papo N, Shai Y. (2006). J Biol Chem
Mookherjee N, et al. (2006). J Immunol
Scott MG, et al. (2002). J Immunol
Elssner A, et al. (2004). J Immunol
Henzler-Wildman KA, et al. (2004). Biochemistry
Koczulla R, et al. (2003). J Clin Invest
Henzler-Wildman KA, Lee DK, Ramamoorthy A. (2003). Biochemistry
De Yang, et al. (2000). J Exp Med
Gudmundsson GH, et al. (1996). Eur J Biochem
Agerberth B, et al. (1995). Proc Natl Acad Sci USA
Also known as: Cathelicidin LL-37, hCAP-18(104-140), CAMP, FALL-39, CAP-18 (human)
Research Use Only
These products are intended for research purposes only and are not for human consumption. Not FDA approved. Not intended to diagnose, treat, cure, or prevent any disease.
| Compound | Type | Molecular weight | CAS number |
|---|---|---|---|
| LL-37This page | Host-defense peptide (37-residue cathelicidin fragment) | 4,493.3 g/mol | 154947-66-7 |
| PT-141 | Synthetic peptide (cyclic heptapeptide) | 1,025.18 g/mol | 189691-06-3 |
| Cardiogen | Synthetic linear tetrapeptide (short peptide bioregulator) | 489.5 g/mol | — |
| Cerebrolysin | Porcine brain-derived neuropeptide and amino-acid preparation (enzymatic hydrolysate; heterogeneous mixture) | Peptide fraction <10 kDa | 12656-61-0 |
| Cortagen | Synthetic linear tetrapeptide | 446.45 g/mol | — |
Comparison of laboratory reference specifications only. For research use only; not a therapeutic comparison.
Quality & methods