Signaling
The human cathelicidin host-defense peptide, investigated in innate-immunity and cell-signaling research.
LL-37 is the only human cathelicidin — a small host-defense (innate-immunity) peptide released from a larger precursor protein (hCAP-18, the product of the CAMP gene). In laboratory and preclinical research it is studied as a model molecule for how the body's innate immune system recognizes microbes: researchers examine how the 37-residue peptide interacts with bacterial membranes and endotoxin (LPS), how it engages cell receptors such as FPR2/FPRL1 and P2X7, and how it figures in cell-signaling and antimicrobial assays.
Last reviewed · For research use only.
Type
Host-defense peptide (37-residue cathelicidin fragment)
Molecular formula
C205H340N60O53
Molecular weight
4,493.3 g/mol
CAS number
154947-66-7
Amino acids
37
Sequence
[LL-37, 37 aa]
Modification
C-terminal antimicrobial peptide of hCAP-18 (CAMP gene product); the cathelin precursor is proteolytically processed to release the 37-residue peptide. Free termini; commonly supplied as an acetate or TFA salt.
The single human cathelicidin, derived from the C-terminus of the hCAP-18 precursor (CAMP gene). Research literature characterizes it as a cationic, amphipathic alpha-helix that associates with anionic microbial membranes and lipopolysaccharide (LPS); reported cell-signaling interactions in the literature include the formyl peptide receptor FPR2/FPRL1, the purinergic receptor P2X7, and an intracellular binding partner (GAPDH) described in monocytes.
Research Focus
Studied in innate-immunity, antimicrobial-mechanism, membrane-interaction, LPS-neutralization and receptor-signaling research models.
LL-37 is the only cathelicidin-family antimicrobial peptide identified in humans. The encoding gene (FALL39 / CAMP) and the peptide were first described in the mid-1990s: Agerberth et al. (1995) identified the precursor while screening a human bone-marrow cDNA library and named the predicted product FALL-39, and Gudmundsson et al. (1996) characterized the human gene and the proteolytic processing of the cathelin precursor (hCAP-18) into the 37-residue peptide in granulocytes — the two leading leucine residues giving the peptide its "LL-37" name. Comprehensive reviews have since catalogued its biochemistry, expression and the broad set of in-vitro and preclinical model systems in which it is studied: Durr, Sudheendra & Ramamoorthy (2006) framed it as the single human cathelicidin from a membrane-biophysics standpoint, while Bucki et al. (2010) and Vandamme et al. (2012) surveyed its antimicrobial, chemotactic and immunomodulatory research literature.
A large structural literature examines how the peptide folds in membrane-mimicking environments. Porcelli et al. (2008), using solution NMR in dodecylphosphocholine micelles, described a helix-break-helix conformation in which hydrophobic residues partition into the micelle interior and hydrophilic residues face the solvent. Wang (2008) reported the structures of LL-37 and its minimal antibacterial fragment KR-12 (residues 18-29) in SDS and dodecylphosphocholine micelles, describing a curved amphipathic helix-bend-helix motif (residues ~2-31) followed by a disordered C-terminal tail. Sancho-Vaello et al. (2020) extended the structural picture with X-ray crystallography and planar-lipid-membrane electrophysiology, reporting tetrameric oligomerization and a defined transmembrane channel in the presence of membrane mimics. Across these studies the recurring methodological theme is how an amphipathic cationic helix is organized at the lipid-water interface.
Mechanistic work centers on how the peptide engages microbial membranes. Henzler-Wildman, Lee & Ramamoorthy (2003) used solid-state NMR of site-labeled peptide in oriented lipid bilayers to show that the amphipathic helix lies parallel to the bilayer surface in both anionic and zwitterionic membranes — a surface orientation that argued against a barrel-stave pore and supported carpet / toroidal-type models of bilayer disruption; companion work examined perturbation of the hydrophobic core of bilayers (Henzler-Wildman et al., 2004). Sevcsik et al. (2008) compared the peptide's behavior across model membranes of differing lipid composition. This body of biophysical research describes membrane association, not a benefit, and informs how cationic amphipathic peptides are thought to act on anionic microbial surfaces.
Beyond direct membrane activity, the peptide is studied as a host-defense signaling molecule. It binds lipopolysaccharide (LPS); Rosenfeld et al. (2006) examined endotoxin neutralization by innate-immunity host-defense peptides and the role of strong peptide-LPS binding and aggregate dissociation, and Coorens / Scott and colleagues (2017) evaluated LPS neutralization in vitro and ex vivo. On the receptor side, De Yang et al. (2000) identified the formyl peptide receptor FPRL1 (FPR2) as a receptor through which the peptide chemoattracts neutrophils, monocytes and T cells; Elssner et al. (2004) described P2X7-receptor-dependent IL-1beta processing and release in LPS-primed monocytes; and Mookherjee et al. (2009) reported GAPDH as an intracellular binding partner in monocytes. Koczulla et al. (2003) examined an FPRL1-linked angiogenic role in chick chorioallantoic-membrane and rabbit hind-limb-ischemia models.
A wide preclinical literature surveys the peptide's antimicrobial spectrum and its interaction with bacterial biofilms. Overhage et al. (2008) reported that the peptide inhibited Pseudomonas aeruginosa biofilm formation in vitro at concentrations well below those needed to inhibit planktonic growth, and affected pre-grown biofilms — work that seeded fragment-library studies identifying biofilm-active truncations of the sequence. Reviews place these antimicrobial and anti-biofilm observations alongside antifungal and antiviral assays within the broader innate-immunity research framework (Bucki et al., 2010; Vandamme et al., 2012). The recurring research question is how a single endogenous host-defense peptide engages diverse microbial targets and microbial-community structures.
Because the full-length peptide is large and its activity is sensitive to environment and salt, much research focuses on minimal active fragments and engineered analogs. The KR-12 fragment (residues 18-29) identified by Wang (2008) is the smallest reported antibacterial segment and a frequent scaffold for structure-activity studies; subsequent peptide-engineering work has examined lipidated and hybrid KR-12 analogs and other truncations to map the determinants of membrane activity and selectivity. This thread situates LL-37 as a template molecule in antimicrobial-peptide design research rather than as a finished agent.
Lyophilized
-20°C
protect from light and moisture; desiccated, ~24 months.
Reconstituted
2-8°C
typically stable days to a few weeks; avoid freeze-thaw.
Cationic amphipathic peptide; activity is sensitive to ionic strength and serum components. Protect from light and moisture; aliquot to avoid freeze-thaw.
Reviews
Vandamme D, et al. (2012). Cell Immunol — Comprehensive review of LL-37 — biochemistry, expression, and antimicrobial, chemotactic and immunomodulatory research model systems
Bucki R, et al. (2010). Arch Immunol Ther Exp (Warsz) — Review of cathelicidin LL-37 antimicrobial, chemotactic and host-defense research functions
Durr UHN, Sudheendra US, Ramamoorthy A. (2006). Biochim Biophys Acta — Membrane-biophysics review of LL-37 as the only human member of the cathelicidin family
Primary research
Sancho-Vaello E, et al. (2020). Sci Rep — X-ray crystallography and planar-lipid-membrane study reporting LL-37 oligomerization and channel formation in membrane mimics
Coorens M, et al. (2011). PLoS One — In vitro and ex vivo study evaluating LPS (endotoxin) neutralization by LL-37
Mookherjee N, et al. (2009). J Immunol — Proteomic study identifying GAPDH as an intracellular binding partner of LL-37 in human monocytes
Overhage J, et al. (2008). Infect Immun — In vitro study reporting LL-37 inhibition of Pseudomonas aeruginosa biofilm formation at sub-inhibitory concentrations
Wang G. (2008). J Biol Chem — NMR structural study of LL-37 and its minimal fragment KR-12 in lipid micelles (helix-bend-helix motif)
Porcelli F, et al. (2008). Biochemistry — Solution-NMR structural study of LL-37 in dodecylphosphocholine micelles (helix-break-helix conformation)
Sevcsik E, et al. (2007). Biochim Biophys Acta — Biophysical study of how membrane lipid composition shapes the mode of action of LL-37 in model membranes
Oren Z, et al. (1999). Biochem J — Structure-function study of LL-37 organization in phospholipid membranes and the basis of its non-cell-selective activity
Johansson J, et al. (1998). J Biol Chem — Study of the conformation-dependent antibacterial activity of the naturally occurring human peptide LL-37
Rosenfeld Y, Papo N, Shai Y. (2006). J Biol Chem — Mechanistic study of endotoxin (LPS) neutralization by innate-immunity host-defense peptides, including LL-37
Mookherjee N, et al. (2006). J Immunol — Study of LL-37 modulation of the TLR-mediated inflammatory response in LPS-stimulated human monocytic cells
Scott MG, et al. (2002). J Immunol — Study characterizing LL-37 as a multifunctional modulator of innate immune responses and an anti-endotoxin agent in murine models
Elssner A, et al. (2004). J Immunol — Study reporting P2X7-receptor-dependent IL-1beta processing and release in LPS-primed monocytes by LL-37
Henzler-Wildman KA, et al. (2004). Biochemistry — Solid-state NMR study of LL-37 perturbation of the hydrophobic core of lipid bilayers
Koczulla R, et al. (2003). J Clin Invest — Study of an FPRL1-linked angiogenic role for LL-37/hCAP-18 in chick chorioallantoic-membrane and rabbit hind-limb-ischemia models
Henzler-Wildman KA, Lee DK, Ramamoorthy A. (2003). Biochemistry — Oriented-bilayer solid-state NMR study of the mechanism of lipid-bilayer disruption by LL-37 (surface-parallel helix)
De Yang, et al. (2000). J Exp Med — Study identifying FPRL1 (FPR2) as a receptor through which LL-37 chemoattracts neutrophils, monocytes and T cells
Gudmundsson GH, et al. (1996). Eur J Biochem — Characterization of the human gene FALL39 and processing of the cathelin precursor to the LL-37 peptide in granulocytes
Agerberth B, et al. (1995). Proc Natl Acad Sci USA — Original report identifying the cysteine-free precursor FALL-39 (LL-37) from a human bone-marrow cDNA library
Also known as: Cathelicidin LL-37, hCAP-18(104-140), CAMP, FALL-39, CAP-18 (human)
Research Use Only
These products are intended for research purposes only and are not for human consumption. Not FDA approved. Not intended to diagnose, treat, cure, or prevent any disease.
| Compound | Type | Molecular weight | CAS number |
|---|---|---|---|
| LL-37This page | Host-defense peptide (37-residue cathelicidin fragment) | 4,493.3 g/mol | 154947-66-7 |
| PT-141 | Synthetic peptide (cyclic heptapeptide) | 1,025.18 g/mol | 189691-06-3 |
| Cardiogen | Synthetic linear tetrapeptide (short peptide bioregulator) | 489.5 g/mol | — |
| Cerebrolysin | Porcine brain-derived neuropeptide and amino-acid preparation (enzymatic hydrolysate; heterogeneous mixture) | Peptide fraction <10 kDa | 12656-61-0 |
| Cortagen | Synthetic linear tetrapeptide | 446.45 g/mol | — |
Comparison of laboratory reference specifications only. For research use only; not a therapeutic comparison.