LuvAminos
ProductsResearchLoyaltyAffiliate ProgramAboutContact us
Browse Catalog
Luvaminos

Research-grade peptides for laboratory and in-vitro research. Third-party tested, documented per batch.

(505) 460-8488

[email protected]

Shop

  • All Products

Resources

  • About
  • Research Library
  • Certificates of Analysis
  • Affiliate Program
  • Loyalty Program
  • Refer a Friend

Support

  • Contact Us
  • FAQ
  • Shipping Info
  • Returns & Refunds

Legal

  • Privacy Policy
  • Your Privacy Choices
  • Terms of Service
  • Affiliate Terms
  • Disclaimer
  • Research Use Only
Shop
  • All Products
Resources
  • About
  • Research Library
  • Certificates of Analysis
  • Affiliate Program
  • Loyalty Program
  • Refer a Friend
Support
  • Contact Us
  • FAQ
  • Shipping Info
  • Returns & Refunds
Legal
  • Privacy Policy
  • Your Privacy Choices
  • Terms of Service
  • Affiliate Terms
  • Disclaimer
  • Research Use Only

!FDA Disclaimer — Research Use Only

Statements regarding these products have not been evaluated by the U.S. Food and Drug Administration. These products are intended for laboratory and in-vitro research use only and are not for human or veterinary consumption of any kind. They are not drugs, foods, or supplements, are not FDA approved, and are not intended to diagnose, treat, cure, or prevent any disease. All products are sold exclusively to qualified researchers and must be handled by trained professionals. Read the full disclaimer →

© 2026 Luvaminos LLC. All Rights Reserved.

1209 Mountain Road PL NE STE R, Albuquerque, NM 87110

  • VisaVISA
  • Mastercard
  • American ExpressAMEX
  • DiscoverDiscover
  • Ethereum
  • SSL Secured
  • 99%+ Purity
  • Shipment Protection
Research/LL-37

Signaling

LL-37

The human cathelicidin host-defense peptide, investigated in innate-immunity and cell-signaling research.

LL-37 is the only human cathelicidin — a small host-defense (innate-immunity) peptide released from a larger precursor protein (hCAP-18, the product of the CAMP gene). In laboratory and preclinical research it is studied as a model molecule for how the body's innate immune system recognizes microbes: researchers examine how the 37-residue peptide interacts with bacterial membranes and endotoxin (LPS), how it engages cell receptors such as FPR2/FPRL1 and P2X7, and how it figures in cell-signaling and antimicrobial assays.

Last reviewed June 20, 2026 · For research use only.

What is LL-37 studied for?

  • Membrane-interaction and membrane-disruption mechanism studies in model lipid bilayers and micelles (carpet / toroidal-pore models)
  • Structural characterization by NMR and X-ray crystallography (helix-bend-helix conformation, oligomerization, channel formation in membrane mimics)
  • Lipopolysaccharide (LPS) / endotoxin binding and neutralization assays
  • Receptor-interaction studies — FPR2/FPRL1 chemotaxis and P2X7-mediated signaling in leukocytes and monocytes
  • Immunomodulation and innate-immune-signaling research in monocytes, neutrophils and dendritic cells
  • Antimicrobial and anti-biofilm assays against Gram-positive and Gram-negative bacteria
  • Peptide-engineering and structure-activity research on minimal active fragments (e.g. KR-12) and analogs

What is the molecular structure of LL-37?

Type

Host-defense peptide (37-residue cathelicidin fragment)

Molecular formula

C205H340N60O53

Molecular weight

4,493.3 g/mol

CAS number

154947-66-7

Amino acids

37

Sequence

[LL-37, 37 aa]

Modification

C-terminal antimicrobial peptide of hCAP-18 (CAMP gene product); the cathelin precursor is proteolytically processed to release the 37-residue peptide. Free termini; commonly supplied as an acetate or TFA salt.

How does LL-37 work?

The single human cathelicidin, derived from the C-terminus of the hCAP-18 precursor (CAMP gene). Research literature characterizes it as a cationic, amphipathic alpha-helix that associates with anionic microbial membranes and lipopolysaccharide (LPS); reported cell-signaling interactions in the literature include the formyl peptide receptor FPR2/FPRL1, the purinergic receptor P2X7, and an intracellular binding partner (GAPDH) described in monocytes.

Research Focus

Studied in innate-immunity, antimicrobial-mechanism, membrane-interaction, LPS-neutralization and receptor-signaling research models.

Origin and molecular identity

LL-37 is the only cathelicidin-family antimicrobial peptide identified in humans. The encoding gene (FALL39 / CAMP) and the peptide were first described in the mid-1990s: Agerberth et al. (1995) identified the precursor while screening a human bone-marrow cDNA library and named the predicted product FALL-39, and Gudmundsson et al. (1996) characterized the human gene and the proteolytic processing of the cathelin precursor (hCAP-18) into the 37-residue peptide in granulocytes — the two leading leucine residues giving the peptide its "LL-37" name. Comprehensive reviews have since catalogued its biochemistry, expression and the broad set of in-vitro and preclinical model systems in which it is studied: Durr, Sudheendra & Ramamoorthy (2006) framed it as the single human cathelicidin from a membrane-biophysics standpoint, while Bucki et al. (2010) and Vandamme et al. (2012) surveyed its antimicrobial, chemotactic and immunomodulatory research literature.

Structure and conformation

A large structural literature examines how the peptide folds in membrane-mimicking environments. Porcelli et al. (2008), using solution NMR in dodecylphosphocholine micelles, described a helix-break-helix conformation in which hydrophobic residues partition into the micelle interior and hydrophilic residues face the solvent. Wang (2008) reported the structures of LL-37 and its minimal antibacterial fragment KR-12 (residues 18-29) in SDS and dodecylphosphocholine micelles, describing a curved amphipathic helix-bend-helix motif (residues ~2-31) followed by a disordered C-terminal tail. Sancho-Vaello et al. (2020) extended the structural picture with X-ray crystallography and planar-lipid-membrane electrophysiology, reporting tetrameric oligomerization and a defined transmembrane channel in the presence of membrane mimics. Across these studies the recurring methodological theme is how an amphipathic cationic helix is organized at the lipid-water interface.

Membrane interaction and antimicrobial mechanism

Mechanistic work centers on how the peptide engages microbial membranes. Henzler-Wildman, Lee & Ramamoorthy (2003) used solid-state NMR of site-labeled peptide in oriented lipid bilayers to show that the amphipathic helix lies parallel to the bilayer surface in both anionic and zwitterionic membranes — a surface orientation that argued against a barrel-stave pore and supported carpet / toroidal-type models of bilayer disruption; companion work examined perturbation of the hydrophobic core of bilayers (Henzler-Wildman et al., 2004). Sevcsik et al. (2008) compared the peptide's behavior across model membranes of differing lipid composition. This body of biophysical research describes membrane association, not a benefit, and informs how cationic amphipathic peptides are thought to act on anionic microbial surfaces.

LPS neutralization and receptor signaling

Beyond direct membrane activity, the peptide is studied as a host-defense signaling molecule. It binds lipopolysaccharide (LPS); Rosenfeld et al. (2006) examined endotoxin neutralization by innate-immunity host-defense peptides and the role of strong peptide-LPS binding and aggregate dissociation, and Coorens / Scott and colleagues (2017) evaluated LPS neutralization in vitro and ex vivo. On the receptor side, De Yang et al. (2000) identified the formyl peptide receptor FPRL1 (FPR2) as a receptor through which the peptide chemoattracts neutrophils, monocytes and T cells; Elssner et al. (2004) described P2X7-receptor-dependent IL-1beta processing and release in LPS-primed monocytes; and Mookherjee et al. (2009) reported GAPDH as an intracellular binding partner in monocytes. Koczulla et al. (2003) examined an FPRL1-linked angiogenic role in chick chorioallantoic-membrane and rabbit hind-limb-ischemia models.

Antimicrobial and anti-biofilm research

A wide preclinical literature surveys the peptide's antimicrobial spectrum and its interaction with bacterial biofilms. Overhage et al. (2008) reported that the peptide inhibited Pseudomonas aeruginosa biofilm formation in vitro at concentrations well below those needed to inhibit planktonic growth, and affected pre-grown biofilms — work that seeded fragment-library studies identifying biofilm-active truncations of the sequence. Reviews place these antimicrobial and anti-biofilm observations alongside antifungal and antiviral assays within the broader innate-immunity research framework (Bucki et al., 2010; Vandamme et al., 2012). The recurring research question is how a single endogenous host-defense peptide engages diverse microbial targets and microbial-community structures.

Fragment engineering and analogs

Because the full-length peptide is large and its activity is sensitive to environment and salt, much research focuses on minimal active fragments and engineered analogs. The KR-12 fragment (residues 18-29) identified by Wang (2008) is the smallest reported antibacterial segment and a frequent scaffold for structure-activity studies; subsequent peptide-engineering work has examined lipidated and hybrid KR-12 analogs and other truncations to map the determinants of membrane activity and selectivity. This thread situates LL-37 as a template molecule in antimicrobial-peptide design research rather than as a finished agent.

How is LL-37 stored & handled?

Lyophilized

-20°C

protect from light and moisture; desiccated, ~24 months.

Reconstituted

2-8°C

typically stable days to a few weeks; avoid freeze-thaw.

Cationic amphipathic peptide; activity is sensitive to ionic strength and serum components. Protect from light and moisture; aliquot to avoid freeze-thaw.

References

Reviews

  1. 1

    Vandamme D, et al. (2012). Cell Immunol — Comprehensive review of LL-37 — biochemistry, expression, and antimicrobial, chemotactic and immunomodulatory research model systems

    DOI: 10.1016/j.cellimm.2012.11.009PubMed 23246832
  2. 2

    Bucki R, et al. (2010). Arch Immunol Ther Exp (Warsz) — Review of cathelicidin LL-37 antimicrobial, chemotactic and host-defense research functions

    DOI: 10.1007/s00005-009-0057-2PubMed 20049649
  3. 3

    Durr UHN, Sudheendra US, Ramamoorthy A. (2006). Biochim Biophys Acta — Membrane-biophysics review of LL-37 as the only human member of the cathelicidin family

    DOI: 10.1016/j.bbamem.2006.03.030PubMed 16716248

Primary research

  1. 4

    Sancho-Vaello E, et al. (2020). Sci Rep — X-ray crystallography and planar-lipid-membrane study reporting LL-37 oligomerization and channel formation in membrane mimics

    DOI: 10.1038/s41598-020-74401-5PubMed 33060695
  2. 5

    Coorens M, et al. (2011). PLoS One — In vitro and ex vivo study evaluating LPS (endotoxin) neutralization by LL-37

    DOI: 10.1371/journal.pone.0026525PubMed 22028895
  3. 6

    Mookherjee N, et al. (2009). J Immunol — Proteomic study identifying GAPDH as an intracellular binding partner of LL-37 in human monocytes

    DOI: 10.4049/jimmunol.0802586PubMed 19605696
  4. 7

    Overhage J, et al. (2008). Infect Immun — In vitro study reporting LL-37 inhibition of Pseudomonas aeruginosa biofilm formation at sub-inhibitory concentrations

    DOI: 10.1128/IAI.00318-08PubMed 18591225
  5. 8

    Wang G. (2008). J Biol Chem — NMR structural study of LL-37 and its minimal fragment KR-12 in lipid micelles (helix-bend-helix motif)

    DOI: 10.1074/jbc.M805533200PubMed 18818205
  6. 9

    Porcelli F, et al. (2008). Biochemistry — Solution-NMR structural study of LL-37 in dodecylphosphocholine micelles (helix-break-helix conformation)

    DOI: 10.1021/bi702036sPubMed 18439024
  7. 10

    Sevcsik E, et al. (2007). Biochim Biophys Acta — Biophysical study of how membrane lipid composition shapes the mode of action of LL-37 in model membranes

    DOI: 10.1016/j.bbamem.2007.06.015PubMed 17662236
  8. 11

    Oren Z, et al. (1999). Biochem J — Structure-function study of LL-37 organization in phospholipid membranes and the basis of its non-cell-selective activity

    DOI: 10.1042/bj3410501PubMed 10417317
  9. 12

    Johansson J, et al. (1998). J Biol Chem — Study of the conformation-dependent antibacterial activity of the naturally occurring human peptide LL-37

    DOI: 10.1074/jbc.273.6.3718PubMed 9452503
  10. 13

    Rosenfeld Y, Papo N, Shai Y. (2006). J Biol Chem — Mechanistic study of endotoxin (LPS) neutralization by innate-immunity host-defense peptides, including LL-37

    DOI: 10.1074/jbc.M507337200PubMed 16330465
  11. 14

    Mookherjee N, et al. (2006). J Immunol — Study of LL-37 modulation of the TLR-mediated inflammatory response in LPS-stimulated human monocytic cells

    DOI: 10.4049/jimmunol.176.4.2455PubMed 16456005
  12. 15

    Scott MG, et al. (2002). J Immunol — Study characterizing LL-37 as a multifunctional modulator of innate immune responses and an anti-endotoxin agent in murine models

    DOI: 10.4049/jimmunol.169.7.3883PubMed 12244186
  13. 16

    Elssner A, et al. (2004). J Immunol — Study reporting P2X7-receptor-dependent IL-1beta processing and release in LPS-primed monocytes by LL-37

    DOI: 10.4049/jimmunol.172.8.4987PubMed 15067080
  14. 17

    Henzler-Wildman KA, et al. (2004). Biochemistry — Solid-state NMR study of LL-37 perturbation of the hydrophobic core of lipid bilayers

    DOI: 10.1021/bi036284sPubMed 15222757
  15. 18

    Koczulla R, et al. (2003). J Clin Invest — Study of an FPRL1-linked angiogenic role for LL-37/hCAP-18 in chick chorioallantoic-membrane and rabbit hind-limb-ischemia models

    DOI: 10.1172/JCI17545PubMed 12782669
  16. 19

    Henzler-Wildman KA, Lee DK, Ramamoorthy A. (2003). Biochemistry — Oriented-bilayer solid-state NMR study of the mechanism of lipid-bilayer disruption by LL-37 (surface-parallel helix)

    DOI: 10.1021/bi0273563PubMed 12767238
  17. 20

    De Yang, et al. (2000). J Exp Med — Study identifying FPRL1 (FPR2) as a receptor through which LL-37 chemoattracts neutrophils, monocytes and T cells

    DOI: 10.1084/jem.192.7.1069PubMed 11015447
  18. 21

    Gudmundsson GH, et al. (1996). Eur J Biochem — Characterization of the human gene FALL39 and processing of the cathelin precursor to the LL-37 peptide in granulocytes

    DOI: 10.1111/j.1432-1033.1996.0325z.xPubMed 8681941
  19. 22

    Agerberth B, et al. (1995). Proc Natl Acad Sci USA — Original report identifying the cysteine-free precursor FALL-39 (LL-37) from a human bone-marrow cDNA library

    DOI: 10.1073/pnas.92.1.195PubMed 7529412

Primary Database

PubChem CID 16198951↗

Also known as: Cathelicidin LL-37, hCAP-18(104-140), CAMP, FALL-39, CAP-18 (human)

Research Use Only

These products are intended for research purposes only and are not for human consumption. Not FDA approved. Not intended to diagnose, treat, cure, or prevent any disease.

How does LL-37 compare to related Signaling research compounds?

Molecular comparison of LL-37 and related Signaling research compounds.
CompoundTypeMolecular weightCAS number
LL-37This pageHost-defense peptide (37-residue cathelicidin fragment)4,493.3 g/mol154947-66-7
PT-141Synthetic peptide (cyclic heptapeptide)1,025.18 g/mol189691-06-3
CardiogenSynthetic linear tetrapeptide (short peptide bioregulator)489.5 g/mol—
CerebrolysinPorcine brain-derived neuropeptide and amino-acid preparation (enzymatic hydrolysate; heterogeneous mixture)Peptide fraction <10 kDa12656-61-0
CortagenSynthetic linear tetrapeptide446.45 g/mol—

Comparison of laboratory reference specifications only. For research use only; not a therapeutic comparison.

Frequently asked questions about LL-37

Quality & methods

  • Storage & handling →
  • How purity is measured →
  • Reading a Certificate of Analysis →