Research updates from Luvaminos
Subscribe for catalog updates, new research compounds, and quality documentation releases.
For researchers and labs. No spam — unsubscribe anytime.
For Research Purposes Only
Out of StockMolecular Profile
Molecular Profile
Type
Host-defense peptide (37-residue cathelicidin fragment)
Molecular formula
C205H340N60O53
Molecular weight
4,493.3 g/mol
CAS number
154947-66-7
Amino acids
37
Sequence
[LL-37, 37 aa]
Modification
C-terminal antimicrobial peptide of hCAP-18 (CAMP gene product); the cathelin precursor is proteolytically processed to release the 37-residue peptide. Free termini; commonly supplied as an acetate or TFA salt.
Mechanism & Target Class
Mechanism & Target Class
The single human cathelicidin, derived from the C-terminus of the hCAP-18 precursor (CAMP gene). Research literature characterizes it as a cationic, amphipathic alpha-helix that associates with anionic microbial membranes and lipopolysaccharide (LPS); additional reported interactions in the literature include cell-surface G-protein-coupled and purinergic receptor classes and an intracellular binding partner (GAPDH) described in monocytes.
Storage & Handling
Storage & Handling
Lyophilized
20°C
protect from light and moisture; desiccated, ~24 months.
Cationic amphipathic peptide; activity is sensitive to ionic strength and serum components. Protect from light and moisture; aliquot to avoid freeze-thaw.
References
References
Reviews
- 1
Vandamme D, et al. (2012). Cell Immunol
- 2
Bucki R, et al. (2010). Arch Immunol Ther Exp (Warsz)
Reviews
- 3
Durr UHN, Sudheendra US, Ramamoorthy A. (2006). Biochim Biophys Acta
Primary research
- 4
Sancho-Vaello E, et al. (2020). Sci Rep
- 5
Coorens M, et al. (2011). PLoS One
- 6
Mookherjee N, et al. (2009). J Immunol
- 7
Overhage J, et al. (2008). Infect Immun
- 8
Wang G. (2008). J Biol Chem
- 9
Porcelli F, et al. (2008). Biochemistry
- 10
Sevcsik E, et al. (2007). Biochim Biophys Acta
- 11
Oren Z, et al. (1999). Biochem J
- 12
Johansson J, et al. (1998). J Biol Chem
- 13
Rosenfeld Y, Papo N, Shai Y. (2006). J Biol Chem
- 14
Mookherjee N, et al. (2006). J Immunol
- 15
Scott MG, et al. (2002). J Immunol
- 16
Elssner A, et al. (2004). J Immunol
- 17
Henzler-Wildman KA, et al. (2004). Biochemistry
- 18
Koczulla R, et al. (2003). J Clin Invest
- 19
Henzler-Wildman KA, Lee DK, Ramamoorthy A. (2003). Biochemistry
- 20
De Yang, et al. (2000). J Exp Med
- 21
Gudmundsson GH, et al. (1996). Eur J Biochem
- 22
Agerberth B, et al. (1995). Proc Natl Acad Sci USA
Primary Database
Primary Database
Also known as: Cathelicidin LL-37, hCAP-18(104-140), CAMP, FALL-39, CAP-18 (human)
View this compound in the Research Library →Research Use Only. All products sold by Luvaminos are intended solely for in vitro research and laboratory use by qualified professionals. They are not approved by the FDA and are not intended for human or animal consumption, therapeutic use, or diagnostic purposes. By purchasing, you confirm you are a licensed researcher or institution and accept full responsibility for compliance with all applicable laws and regulations.
