Research updates from Luvaminos
Subscribe for catalog updates, new research compounds, and quality documentation releases.
For researchers and labs. No spam — unsubscribe anytime.
For Research Purposes Only
Out of StockFOXO4-DRI
Third-Party TestedPurity Standards
Total
$59.99Size
Quantity
1
Bundle & Save
Molecular Profile
Molecular Profile
Type
Synthetic D-retro-inverso peptide (45 residues)
Molecular formula
C228H388N86O64
Molecular weight
5358.05 g/mol
CAS number
2460055-10-9
Amino acids
45
Sequence
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-retro-inverso isoform)
Modification
All-D-amino-acid retro-inverso isoform (reversed sequence of the FOXO4 p53-interacting segment); free N- and C-termini.
Mechanism & Target Class
Mechanism & Target Class
FOXO4-DRI corresponds to the reversed, all-D-amino-acid version of the FOXO4 segment that engages the tumor-suppressor protein p53; it carries an arginine-rich cell-penetrating segment at its C-terminus. The research literature characterizes it as a competitive disruptor of the FOXO4–p53 protein–protein interaction. In the originating model (Baar et al., 2017), FOXO4 is described as sequestering p53 in nuclear PML bodies in senescent cells; the peptide is studied for its capacity to interfere with that interaction, and assays measure p53 nuclear localization and apoptosis endpoints in senescent versus non-senescent cell cultures. Subsequent solution-NMR and biophysical work has mapped the binding interface to the disordered p53 transactivation domain and the FOXO4 forkhead domain (Bourgeois et al., 2025; Kohoutova et al., 2025).
Storage & Handling
Storage & Handling
Lyophilized
−20°C desiccated and protected from light
−80°C for long-term storage.
Large arginine-rich peptide; protect from light and moisture and avoid freeze-thaw cycles.
References
References
Reviews
- 1
Chaib S, Tchkonia T, Kirkland JL. (2022). Nat Med
- 2
Gorgoulis V, et al. (2019). Cell
Reviews
- 3
Bourgeois B, Madl T. (2018). FEBS Lett
Primary research
- 4
Huang H, et al. (2026). Front Bioeng Biotechnol
- 5
Bourgeois B, et al. (2025). Nat Commun
- 6
Kohoutova K, et al. (2025). Nat Commun
- 7
Kong X, et al. (2025). Commun Biol
- 8
Kang H, et al. (2024). Commun Biol
- 9
Kim J, et al. (2022). FEBS J
- 10
Mandal R, et al. (2022). Protein Sci
- 11
Han X, et al. (2022). J Cell Mol Med
- 12
Le HH, et al. (2021). EBioMedicine
- 13
Huang Y, et al. (2021). Front Bioeng Biotechnol
- 14
Zhang C, et al. (2020). Aging (Albany NY)
- 15
Baar MP, et al. (2017). Cell
Primary Database
Primary Database
Also known as: FOXO4 D-Retro-Inverso, FOXO4-DRI peptide, FOXO4 DRI
View this compound in the Research Library →Research Use Only. All products sold by Luvaminos are intended solely for in vitro research and laboratory use by qualified professionals. They are not approved by the FDA and are not intended for human or animal consumption, therapeutic use, or diagnostic purposes. By purchasing, you confirm you are a licensed researcher or institution and accept full responsibility for compliance with all applicable laws and regulations.
