Research updates from Luvaminos
Subscribe for catalog updates, new research compounds, and quality documentation releases.
For researchers and labs. No spam — unsubscribe anytime.
For Research Purposes Only
Out of StockIGF-DES
Third-Party TestedPurity Standards
Total
$79.99Size
Quantity
1
Bundle & Save
Molecular Profile
Molecular Profile
Type
Truncated protein variant (67 residues)
Molecular formula
C319H495N91O96S7
Molecular weight
~7,365 g/mol (~7.4 kDa)
CAS number
112603-35-7
Amino acids
67
Sequence
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Modification
N-terminal truncation of human IGF-1: residues 4-70, with the Gly-Pro-Glu tripeptide absent from the N-terminus; three intramolecular disulfide bonds retained from the parent protein.
Mechanism & Target Class
Mechanism & Target Class
An N-terminally truncated form of insulin-like growth factor 1 (IGF-1) corresponding to residues 4-70, lacking the Gly-Pro-Glu tripeptide at the N-terminus, with the three intramolecular disulfide bonds of the parent protein retained. The absence of this tripeptide - and of Glu3 in particular - lowers its affinity for the IGF-binding proteins (IGFBPs) while leaving its receptor-binding surface intact, which is the structural basis for its use as a binding-protein-decoupled comparator in molecular research.
Storage & Handling
Storage & Handling
Lyophilized
20°C, protected from light
lyophilized powder stable long term.
Disulfide-bonded protein; sensitive to repeated freeze-thaw and oxidation.
References
References
Reviews
- 1
Ballard FJ, Wallace JC, Francis GL, Read LC, Tomas FM. (1996). Int J Biochem Cell Biol
Primary research
- 2
Heding A, Gill R, Ogawa Y, De Meyts P, Shymko RM. (1996). J Biol Chem
Primary research
- 3
Lemmey AB, Ballard FJ, Martin AA, Tomas FM, Howarth GS, Read LC. (1994). Growth Factors
- 4
Francis GL, Ross M, Ballard FJ, Milner SJ, Senn C, McNeil KA, Wallace JC, King R, Wells JR. (1992). J Mol Endocrinol
- 5
Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ. (1992). Biochem J
- 6
Cooke RM, Harvey TS, Campbell ID. (1991). Biochemistry
- 7
Tomas FM, Knowles SE, Owens PC, Read LC, Chandler CS, Gargosky SE, Ballard FJ. (1991). Biochem J
- 8
Tomas FM, Knowles SE, Owens PC, Read LC, Chandler CS, Gargosky SE, Ballard FJ. (1991). J Endocrinol
- 9
Lemmey AB, Martin AA, Read LC, Tomas FM, Owens PC, Ballard FJ. (1991). Am J Physiol
- 10
Martin AA, Tomas FM, Owens PC, Knowles SE, et al. (1991). Am J Physiol-Renal
- 11
Gillespie C, Read LC, Bagley CJ, Ballard FJ. (1990). J Endocrinol
- 12
Bagley CJ, May BL, Szabo L, McNamara PJ, Ross M, Francis GL, Ballard FJ, Wallace JC. (1989). Biochem J
- 13
Ross M, Francis GL, Szabo L, Wallace JC, Ballard FJ. (1989). Biochem J
- 14
Carlsson-Skwirut C, Lake M, Hartmanis M, Hall K, Sara VR. (1989). Biochim Biophys Acta
- 15
Francis GL, Upton FM, Ballard FJ, McNeil KA, Wallace JC. (1988). Biochem J
- 16
Szabo L, Mottershead DG, Ballard FJ, Wallace JC. (1988). Biochem Biophys Res Commun
- 17
Ballard FJ, Francis GL, Ross M, Bagley CJ, May B, Wallace JC. (1987). Biochem Biophys Res Commun
- 18
Sara VR, Carlsson-Skwirut C, Andersson C, Hall E, Sjögren B, Holmgren A, Jörnvall H. (1986). Proc Natl Acad Sci USA
- 19
Francis GL, Read LC, Ballard FJ, Bagley CJ, Upton FM, Gravestock PM, Wallace JC. (1986). Biochem J
Primary Database
Primary Database
Also known as: Des(1-3)IGF-1, Destripeptide IGF-1, des-(1-3)-IGF-I
View this compound in the Research Library →Research Use Only. All products sold by Luvaminos are intended solely for in vitro research and laboratory use by qualified professionals. They are not approved by the FDA and are not intended for human or animal consumption, therapeutic use, or diagnostic purposes. By purchasing, you confirm you are a licensed researcher or institution and accept full responsibility for compliance with all applicable laws and regulations.
