LuvAminos
ProductsResearchLoyaltyAffiliate ProgramAboutContact us
Browse Catalog
Luvaminos

Research-grade peptides for laboratory and in-vitro research. Third-party tested, documented per batch.

(505) 460-8488

[email protected]

Shop

  • All Products

Resources

  • About
  • Research Library
  • Certificates of Analysis
  • Affiliate Program
  • Loyalty Program
  • Refer a Friend

Support

  • Contact Us
  • FAQ
  • Shipping Info
  • Returns & Refunds

Legal

  • Privacy Policy
  • Your Privacy Choices
  • Terms of Service
  • Affiliate Terms
  • Disclaimer
  • Research Use Only
Shop
  • All Products
Resources
  • About
  • Research Library
  • Certificates of Analysis
  • Affiliate Program
  • Loyalty Program
  • Refer a Friend
Support
  • Contact Us
  • FAQ
  • Shipping Info
  • Returns & Refunds
Legal
  • Privacy Policy
  • Your Privacy Choices
  • Terms of Service
  • Affiliate Terms
  • Disclaimer
  • Research Use Only

!FDA Disclaimer — Research Use Only

Statements regarding these products have not been evaluated by the U.S. Food and Drug Administration. These products are intended for laboratory and in-vitro research use only and are not for human or veterinary consumption of any kind. They are not drugs, foods, or supplements, are not FDA approved, and are not intended to diagnose, treat, cure, or prevent any disease. All products are sold exclusively to qualified researchers and must be handled by trained professionals. Read the full disclaimer →

© 2026 Luvaminos LLC. All Rights Reserved.

1209 Mountain Road PL NE STE R, Albuquerque, NM 87110

  • VisaVISA
  • Mastercard
  • American ExpressAMEX
  • DiscoverDiscover
  • Ethereum
  • SSL Secured
  • 99%+ Purity
  • Shipment Protection
Research/IGF-DES

Cellular

IGF-DES

A truncated insulin-like growth factor variant studied as a binding-protein-decoupled tool in cellular research models.

IGF-DES is a naturally occurring, N-terminally truncated variant of insulin-like growth factor 1 (IGF-1), missing the first three amino acids of the parent protein. Because that truncation lowers its interaction with the IGF-binding proteins while leaving its receptor interaction intact, it is used in laboratory research as a tool for separating binding-protein interactions from receptor interactions. It appears in cell-culture and preclinical rodent studies of the IGF signaling system.

Last reviewed June 20, 2026 · For research use only.

What is IGF-DES studied for?

  • Receptor- and binding-protein interaction assays at the type-1 IGF receptor and the IGF-binding proteins
  • Biosensor binding-kinetics studies of IGF / IGF-binding-protein interactions
  • L6 and C2C12 myoblast protein- and DNA-synthesis assays
  • Hepatoma, breast-carcinoma, fibroblast, and fetal-brain cell-culture models
  • Preclinical rodent model systems (streptozotocin-diabetic, dexamethasone-treated, dietary nitrogen-restriction, small-bowel-resection, reduced-renal-mass)
  • Structure-function mapping of the IGF-1 N-terminal region

What is the molecular structure of IGF-DES?

Type

Truncated protein variant (67 residues)

Molecular formula

C319H495N91O96S7

Molecular weight

~7,365 g/mol (~7.4 kDa)

CAS number

112603-35-7

Amino acids

67

Sequence

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Modification

N-terminal truncation of human IGF-1: residues 4-70, with the Gly-Pro-Glu tripeptide absent from the N-terminus; three intramolecular disulfide bonds retained from the parent protein.

How does IGF-DES work?

An N-terminally truncated form of insulin-like growth factor 1 (IGF-1) corresponding to residues 4-70, lacking the Gly-Pro-Glu tripeptide at the N-terminus. The absence of this tripeptide - and of Glu3 in particular - lowers its affinity for the IGF-binding proteins (IGFBPs) while preserving affinity for the type-1 IGF receptor (IGF-1R); downstream IGF-1R signaling proceeds through the PI3K/Akt and MAPK/ERK pathways.

Research Focus

Used as an IGF-binding-protein-resistant comparator in IGF-1 receptor signaling and cellular research.

Molecular Origin and Structure

IGF-DES is a naturally occurring, truncated form of insulin-like growth factor 1 (IGF-1). It was first characterized from human fetal brain (Sara et al., 1986) and from bovine colostrum (Francis et al., 1986; Francis et al., 1988), where it is thought to arise from post-translational cleavage of IGF-1. Structurally it is a 67-residue variant corresponding to residues 4-70 of mature human IGF-1, with the N-terminal Gly-Pro-Glu tripeptide absent; the three intramolecular disulfide bonds of the parent protein are retained. No high-resolution structure of the truncated variant itself has been reported, so structural work references the parent IGF-1 - the nuclear-magnetic-resonance solution-structure study of Cooke et al. (1991) is the standard structural reference, and the relationship between the variant and the full-length parent is described in structural and binding terms rather than treated as identical.

Binding-Protein and Receptor Interactions

The defining research theme is how N-terminal truncation alters interaction with the IGF-binding proteins (IGFBPs). Receptor-binding and competition studies examined IGF-DES alongside full-length IGF-1, characterizing its interaction with the IGFBPs relative to its binding at the type-1 IGF receptor (Carlsson-Skwirut et al., 1989; Ross et al., 1989). Szabo et al. (1988) examined a purified IGFBP and the role of the IGF-1 N-terminal tripeptide in its binding. Heding et al. (1996) applied biosensor (surface-plasmon-resonance) kinetics to characterize the interaction of IGF-DES with IGF-binding-protein-3, and Francis et al. (1992) compared a panel of N-terminal IGF-1 analogues, including IGF-DES, in binding-protein-secreting cell lines. Structure-function work by Bagley et al. (1989) mapped the contribution of the IGF-1 N-terminal region, examining how stepwise removal of the first residues - and the loss of Glu3 in particular - relates to receptor binding in a myoblast system.

Cellular Research Models

The L6 rat myoblast protein-synthesis bioassay is the foundational in-vitro system in which IGF-DES was first characterized (Ballard et al., 1987), and the molecule recurs there as an IGFBP-resistant comparator to full-length IGF-1. DNA-synthesis assays in fetal rat brain cells were used to compare intact and truncated recombinant IGF-1 (Carlsson-Skwirut et al., 1989). Across the broader literature the reported cell systems include L6 and C2C12 myoblasts, H35 hepatoma cells, MCF-7 breast-carcinoma cells, BALB/c 3T3 and primary fibroblasts, and fetal-brain cells, where IGF-DES has been used to probe how IGFBPs modulate receptor-level signaling. Downstream IGF-1R signaling in these contexts is described through the PI3K/Akt and MAPK/ERK cascades (general IGF-1R biology).

Preclinical Rodent Models

IGF-DES has been used as an IGFBP-resistant comparator to full-length IGF-1 across several rat catabolic-state model systems, with whole-body nitrogen balance as a common measurement endpoint. The model systems examined include streptozotocin-diabetic rats (Tomas et al., 1991), dexamethasone-treated rats (Tomas et al., 1992), dietary nitrogen restriction (Tomas et al., 1991), small-bowel / gut resection (Lemmey et al., 1991; Lemmey et al., 1994), and reduced renal mass via subtotal nephrectomy (Martin et al., 1991). The molecule was also examined in growth-hormone-deficient lit/lit mice (Gillespie et al., 1990). Across these reports IGF-DES is studied as a research tool rather than as a therapeutic candidate; the descriptions here cover the model systems and what was measured, not biological outcomes.

Role as a Mechanistic Comparator

Taken together, the literature positions IGF-DES as the binding-protein-decoupled reference point of the IGF system. Study designs commonly pair it with full-length IGF-1 (which retains full IGFBP interaction) and with a separate IGFBP-resistant IGF-1 analogue so that observed differences can be attributed to binding-protein interaction versus receptor binding. This makes IGF-DES a recurring mechanistic control in IGF-system research, and reviews of the truncated variant (Ballard et al., 1996) summarize its origin, structure, and use in this comparator role.

How is IGF-DES stored & handled?

Lyophilized

-20°C, protected from light

lyophilized powder stable long term.

Reconstituted

2-8°C

aliquot to minimize freeze-thaw cycles and ambient exposure.

Disulfide-bonded protein; sensitive to repeated freeze-thaw and oxidation.

References

Reviews

  1. 1

    Ballard FJ, Wallace JC, Francis GL, Read LC, Tomas FM. (1996). Int J Biochem Cell Biol — Review of IGF-DES, the truncated form of insulin-like growth factor-I

    DOI: 10.1016/1357-2725(96)00056-8PubMed 8930132

Primary research

  1. 2

    Heding A, Gill R, Ogawa Y, De Meyts P, Shymko RM. (1996). J Biol Chem — Biosensor binding-kinetics study examining IGF-DES interaction with IGF-binding-protein-3

    DOI: 10.1074/jbc.271.24.13948PubMed 8662901
  2. 3

    Lemmey AB, Ballard FJ, Martin AA, Tomas FM, Howarth GS, Read LC. (1994). Growth Factors — Rat small-bowel-resection model study examining IGF-DES and IGF-1 peptides

    PubMed 7803042

Primary research

  1. 4

    Francis GL, Ross M, Ballard FJ, Milner SJ, Senn C, McNeil KA, Wallace JC, King R, Wells JR. (1992). J Mol Endocrinol — Comparative study examining N-terminal IGF-1 analogues, including IGF-DES, in binding-protein-secreting cell models

    DOI: 10.1677/jme.0.0080213PubMed 1378742
  2. 5

    Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ. (1992). Biochem J — Dexamethasone-treated rat model study examining IGF-DES and full-length IGF-1

    DOI: 10.1042/bj2820091PubMed 1371669
  3. 6

    Cooke RM, Harvey TS, Campbell ID. (1991). Biochemistry — NMR solution-structure study of the parent insulin-like growth factor 1 (structural reference for the truncated variant)

    DOI: 10.1021/bi00236a022PubMed 2036417
  4. 7

    Tomas FM, Knowles SE, Owens PC, Read LC, Chandler CS, Gargosky SE, Ballard FJ. (1991). Biochem J — Streptozotocin-diabetic rat model study examining IGF-DES and IGF-1

    DOI: 10.1042/bj2760547
  5. 8

    Tomas FM, Knowles SE, Owens PC, Read LC, Chandler CS, Gargosky SE, Ballard FJ. (1991). J Endocrinol — Nitrogen-restricted rat model study examining full-length and truncated IGF-1

    PubMed 1999680
  6. 9

    Lemmey AB, Martin AA, Read LC, Tomas FM, Owens PC, Ballard FJ. (1991). Am J Physiol — Rat gut-resection model study examining IGF-DES and IGF-1

    PubMed 1996625
  7. 10

    Martin AA, Tomas FM, Owens PC, Knowles SE, et al. (1991). Am J Physiol-Renal — Reduced-renal-mass rat model study examining IGF-DES and IGF-1

    DOI: 10.1152/ajprenal.1991.261.4.F626
  8. 11

    Gillespie C, Read LC, Bagley CJ, Ballard FJ. (1990). J Endocrinol — Growth-hormone-deficient (lit/lit) mouse model study examining IGF-DES relative to IGF-1

    DOI: 10.1677/joe.0.1270401PubMed 2280209
  9. 12

    Bagley CJ, May BL, Szabo L, McNamara PJ, Ross M, Francis GL, Ballard FJ, Wallace JC. (1989). Biochem J — Structure-function study mapping the IGF-1 N-terminal region and truncated variants in a myoblast system

    DOI: 10.1042/bj2590665
  10. 13

    Ross M, Francis GL, Szabo L, Wallace JC, Ballard FJ. (1989). Biochem J — Cell-culture study examining IGF-binding-protein interaction with IGF-1, IGF-2, and IGF-DES

    View source ↗
  11. 14

    Carlsson-Skwirut C, Lake M, Hartmanis M, Hall K, Sara VR. (1989). Biochim Biophys Acta — Comparative study examining recombinant intact and truncated IGF-1 in fetal rat brain cell models

    DOI: 10.1016/0167-4889(89)90209-7PubMed 2469478
  12. 15

    Francis GL, Upton FM, Ballard FJ, McNeil KA, Wallace JC. (1988). Biochem J — Study examining IGF-1 and IGF-2 in bovine colostrum and a truncated form

    DOI: 10.1042/bj2510095PubMed 3390164
  13. 16

    Szabo L, Mottershead DG, Ballard FJ, Wallace JC. (1988). Biochem Biophys Res Commun — Study examining the N-terminal tripeptide requirement for IGF-binding-protein binding to IGF-1

    DOI: 10.1016/0006-291x(88)90580-3
  14. 17

    Ballard FJ, Francis GL, Ross M, Bagley CJ, May B, Wallace JC. (1987). Biochem Biophys Res Commun — Study examining natural and synthetic IGF-1 forms and the truncated derivative IGF-DES in a myoblast assay

    DOI: 10.1016/0006-291x(87)90380-9
  15. 18

    Sara VR, Carlsson-Skwirut C, Andersson C, Hall E, Sjögren B, Holmgren A, Jörnvall H. (1986). Proc Natl Acad Sci USA — Characterization study identifying a truncated IGF-1 variant in human fetal brain

    DOI: 10.1073/pnas.83.13.4904PubMed 3460078
  16. 19

    Francis GL, Read LC, Ballard FJ, Bagley CJ, Upton FM, Gravestock PM, Wallace JC. (1986). Biochem J — Purification and partial-sequence study of IGF-1 from bovine colostrum

    DOI: 10.1042/bj2330207PubMed 3954725

Primary Database

PubChem SID 135331146↗

Also known as: Des(1-3)IGF-1, Destripeptide IGF-1, des-(1-3)-IGF-I

Research Use Only

These products are intended for research purposes only and are not for human consumption. Not FDA approved. Not intended to diagnose, treat, cure, or prevent any disease.

How does IGF-DES compare to related Cellular research compounds?

Molecular comparison of IGF-DES and related Cellular research compounds.
CompoundTypeMolecular weightCAS number
IGF-DESThis pageTruncated protein variant (67 residues)~7,365 g/mol (~7.4 kDa)112603-35-7
BPC-157Synthetic peptide (pentadecapeptide)1,419.5 g/mol137525-51-0
TB-500Synthetic peptide (Thymosin Beta-4 related)~4,963 g/mol77591-33-4
EpithalonSynthetic linear tetrapeptide390.35 g/mol307297-39-8
SS-31Synthetic aromatic-cationic tetrapeptide (C-terminally amidated, mitochondria-targeted)639.8 g/mol736992-21-5

Comparison of laboratory reference specifications only. For research use only; not a therapeutic comparison.

Frequently asked questions about IGF-DES

Quality & methods

  • Storage & handling →
  • How purity is measured →
  • Reading a Certificate of Analysis →