IGF-1 LR3

An IGFBP-resistant recombinant analogue of insulin-like growth factor-1 studied in receptor-signaling, structural, and serum-free cell-culture research.

View IGF-1 LR3 in the store

Molecular Profile

Type
Recombinant single-chain polypeptide analogue of human IGF-1 (83 residues)
Molecular formula
C400H625N111O115S9
Molecular weight
~9,117 g/mol (~9.1 kDa)
CAS number
946870-92-4
Amino acids
83
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Modification
13-residue hydrophobic N-terminal extension (MFPAMPLSSLFVN) joined to the IGF-1 core through a Val-Asn link, plus a Glu3->Arg3 substitution; three intramolecular disulfide bridges as in native IGF-1.

Mechanism & Target Class

A single-chain polypeptide analogue whose structural binding partner is a receptor tyrosine kinase of the insulin-receptor structural family. The native IGF-1 core retains the three-helix fold and three disulfide bridges of the IGF/insulin family, leaving the receptor-binding region structurally intact. The Glu3->Arg substitution and the hydrophobic 13-residue N-terminal extension alter the charge and steric environment at the N-terminus, lowering affinity for the IGF-binding proteins (IGFBP-1 through -6) that otherwise sequester native IGF-1, while preserving the structural binding determinants of the native core.

Storage & Handling

Lyophilized
-20°C long term; protect from moisture.
Handling
Disulfide-bonded protein; sensitive to repeated freeze-thaw and oxidation.

Primary Database

PubChem CID 381123731 ↗

References (22)

  1. Reviews

    1

    Werner H. (2023). Int J Mol Sci

    DOI: 10.3390/ijms241914882

  2. 2

    Khan MZ, Zugaza JL, Torres Aleman I. (2024). J Biol Chem

    DOI: 10.1016/j.jbc.2024.108047PubMed 39638246

  3. 3

    Lin SL, Lin CY, Lee W, Teng CF, Shyu WC, Jeng LB. (2022). Int J Mol Sci

    DOI: 10.3390/ijms231911781PubMed 36233084

  4. Primary research

    4

    White A, Stremming J, Wesolowski SR, Al-Juboori SI, Dobrinskikh E, Limesand SW, Brown LD, Rozance PJ. (2025). Am J Physiol Endocrinol Metab

    DOI: 10.1152/ajpendo.00259.2024PubMed 39679943

  5. 5

    Mongongu C, Coudoré F, Domergue V, Ericsson M, Buisson C, Marchand A. (2021). Drug Test Anal

    DOI: 10.1002/dta.3016PubMed 33587816

  6. 6

    Qian Y, Lewis AM, Sidnam SM, et al. (2017). Process Biochem

    DOI: 10.1016/j.procbio.2016.11.018

  7. 7

    Dahodwala H, Nowey M, Mitina T, Sharfstein ST. (2012). Cytotechnology

    DOI: 10.1007/s10616-011-9388-z

  8. 8

    Voorhamme D, Yandell CA. (2006). Mol Biotechnol

    DOI: 10.1385/MB:34:2:201PubMed 17172665

  9. 9

    Bieberich E. (2005). Anal Biochem

    DOI: 10.1016/j.ab.2005.07.042PubMed 16169509

  10. 10

    Morris AE, Schmid J. (2000). Biotechnol Prog

    DOI: 10.1021/bp0000914PubMed 11027158

  11. 11

    Laajoki LG, Francis GL, Wallace JC, Carver JA, Keniry MA. (2000). J Biol Chem

    DOI: 10.1074/jbc.275.14.10009PubMed 10744677

  12. 12

    Conlon MA, Tomas FM, Owens PC, Wallace JC, Howarth GS, Ballard FJ. (1995). J Endocrinol

    PubMed 7561636

  13. 13

    Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ. (1992). Biochem J

    DOI: 10.1042/bj2820091PubMed 1371669

  14. 14

    Francis GL, Ross M, Ballard FJ, Milner SJ, Senn C, McNeil KA, Wallace JC, King R, Wells JR. (1992). J Mol Endocrinol

    DOI: 10.1677/jme.0.0080213PubMed 1378742

  15. 15

    King R, Wells JR, Krieg P, Snoswell M, Brazier J, Bagley CJ, Wallace JC, Ballard FJ, Ross M, Francis GL. (1992). J Mol Endocrinol

    DOI: 10.1677/jme.0.0080029PubMed 1311930

  16. 16

    Laajoki LG, Le Breton E, Shooter GK, Wallace JC, Francis GL, Carver JA, Keniry MA. (1997). FEBS Lett

    DOI: 10.1016/S0014-5793(97)01496-8PubMed 9450557

  17. 17

    Prelle K, Stojkovic M, Boxhammer K, Motlik J, Ewald D, Arnold GJ, Wolf E. (2001). Endocrinology

    DOI: 10.1210/endo.142.3.8038PubMed 11181549

  18. 18

    Gettmann J, Timmermann C, Becker J, et al. (2013). BMC Proc

    DOI: 10.1186/1753-6561-7-S6-P5

  19. 19

    Li J, Choi E, Yu H, Bai XC. (2019). Nat Commun

    DOI: 10.1038/s41467-019-12564-0PubMed 31594955

  20. 20

    Stremming J, Heard S, White A, Chang EI, Shaw SC, Wesolowski SR, Jonker SS, Rozance PJ, Brown LD. (2021). Am J Physiol Endocrinol Metab

    DOI: 10.1152/ajpendo.00453.2020PubMed 33427051

  21. 21

    White A, Stremming J, Boehmer BH, Chang EI, Jonker SS, Wesolowski SR, Brown LD, Rozance PJ. (2021). Am J Physiol Endocrinol Metab

    DOI: 10.1152/ajpendo.00623.2020PubMed 33938236

  22. 22

    White A, Stremming J, Brown LD, Rozance PJ. (2023). J Dev Orig Health Dis

    DOI: 10.1017/S2040174423000090PubMed 37114757