IGF-DES

A truncated insulin-like growth factor variant studied as a binding-protein-decoupled tool in cellular research models.

Molecular Profile

Type
Truncated protein variant (67 residues)
Molecular formula
C319H495N91O96S7
Molecular weight
~7,365 g/mol (~7.4 kDa)
CAS number
112603-35-7
Amino acids
67
Sequence
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Modification
N-terminal truncation of human IGF-1: residues 4-70, with the Gly-Pro-Glu tripeptide absent from the N-terminus; three intramolecular disulfide bonds retained from the parent protein.

Mechanism & Target Class

An N-terminally truncated form of insulin-like growth factor 1 (IGF-1) corresponding to residues 4-70, lacking the Gly-Pro-Glu tripeptide at the N-terminus, with the three intramolecular disulfide bonds of the parent protein retained. The absence of this tripeptide - and of Glu3 in particular - lowers its affinity for the IGF-binding proteins (IGFBPs) while leaving its receptor-binding surface intact, which is the structural basis for its use as a binding-protein-decoupled comparator in molecular research.

Storage & Handling

Lyophilized
-20°C, protected from light; lyophilized powder stable long term.
Handling
Disulfide-bonded protein; sensitive to repeated freeze-thaw and oxidation.

Primary Database

PubChem SID 135331146 ↗

References (19)

  1. Reviews

    1

    Ballard FJ, Wallace JC, Francis GL, Read LC, Tomas FM. (1996). Int J Biochem Cell Biol

    DOI: 10.1016/1357-2725(96)00056-8PubMed 8930132

  2. Primary research

    2

    Heding A, Gill R, Ogawa Y, De Meyts P, Shymko RM. (1996). J Biol Chem

    DOI: 10.1074/jbc.271.24.13948PubMed 8662901

  3. 3

    Lemmey AB, Ballard FJ, Martin AA, Tomas FM, Howarth GS, Read LC. (1994). Growth Factors

    PubMed 7803042

  4. 4

    Francis GL, Ross M, Ballard FJ, Milner SJ, Senn C, McNeil KA, Wallace JC, King R, Wells JR. (1992). J Mol Endocrinol

    DOI: 10.1677/jme.0.0080213PubMed 1378742

  5. 5

    Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ. (1992). Biochem J

    DOI: 10.1042/bj2820091PubMed 1371669

  6. 6

    Cooke RM, Harvey TS, Campbell ID. (1991). Biochemistry

    DOI: 10.1021/bi00236a022PubMed 2036417

  7. 7

    Tomas FM, Knowles SE, Owens PC, Read LC, Chandler CS, Gargosky SE, Ballard FJ. (1991). Biochem J

    DOI: 10.1042/bj2760547

  8. 8

    Tomas FM, Knowles SE, Owens PC, Read LC, Chandler CS, Gargosky SE, Ballard FJ. (1991). J Endocrinol

    PubMed 1999680

  9. 9

    Lemmey AB, Martin AA, Read LC, Tomas FM, Owens PC, Ballard FJ. (1991). Am J Physiol

    PubMed 1996625

  10. 10

    Martin AA, Tomas FM, Owens PC, Knowles SE, et al. (1991). Am J Physiol-Renal

    DOI: 10.1152/ajprenal.1991.261.4.F626

  11. 11

    Gillespie C, Read LC, Bagley CJ, Ballard FJ. (1990). J Endocrinol

    DOI: 10.1677/joe.0.1270401PubMed 2280209

  12. 12

    Bagley CJ, May BL, Szabo L, McNamara PJ, Ross M, Francis GL, Ballard FJ, Wallace JC. (1989). Biochem J

    DOI: 10.1042/bj2590665

  13. 13

    Ross M, Francis GL, Szabo L, Wallace JC, Ballard FJ. (1989). Biochem J

    Source

  14. 14

    Carlsson-Skwirut C, Lake M, Hartmanis M, Hall K, Sara VR. (1989). Biochim Biophys Acta

    DOI: 10.1016/0167-4889(89)90209-7PubMed 2469478

  15. 15

    Francis GL, Upton FM, Ballard FJ, McNeil KA, Wallace JC. (1988). Biochem J

    DOI: 10.1042/bj2510095PubMed 3390164

  16. 16

    Szabo L, Mottershead DG, Ballard FJ, Wallace JC. (1988). Biochem Biophys Res Commun

    DOI: 10.1016/0006-291x(88)90580-3

  17. 17

    Ballard FJ, Francis GL, Ross M, Bagley CJ, May B, Wallace JC. (1987). Biochem Biophys Res Commun

    DOI: 10.1016/0006-291x(87)90380-9

  18. 18

    Sara VR, Carlsson-Skwirut C, Andersson C, Hall E, Sjögren B, Holmgren A, Jörnvall H. (1986). Proc Natl Acad Sci USA

    DOI: 10.1073/pnas.83.13.4904PubMed 3460078

  19. 19

    Francis GL, Read LC, Ballard FJ, Bagley CJ, Upton FM, Gravestock PM, Wallace JC. (1986). Biochem J

    DOI: 10.1042/bj2330207PubMed 3954725