LL-37

The human cathelicidin host-defense peptide, investigated in innate-immunity and cell-signaling research.

Molecular Profile

Type
Host-defense peptide (37-residue cathelicidin fragment)
Molecular formula
C205H340N60O53
Molecular weight
4,493.3 g/mol
CAS number
154947-66-7
Amino acids
37
Sequence
[LL-37, 37 aa]
Modification
C-terminal antimicrobial peptide of hCAP-18 (CAMP gene product); the cathelin precursor is proteolytically processed to release the 37-residue peptide. Free termini; commonly supplied as an acetate or TFA salt.

Mechanism & Target Class

The single human cathelicidin, derived from the C-terminus of the hCAP-18 precursor (CAMP gene). Research literature characterizes it as a cationic, amphipathic alpha-helix that associates with anionic microbial membranes and lipopolysaccharide (LPS); additional reported interactions in the literature include cell-surface G-protein-coupled and purinergic receptor classes and an intracellular binding partner (GAPDH) described in monocytes.

Storage & Handling

Lyophilized
-20°C; protect from light and moisture; desiccated, ~24 months.
Handling
Cationic amphipathic peptide; activity is sensitive to ionic strength and serum components. Protect from light and moisture; aliquot to avoid freeze-thaw.

Primary Database

PubChem CID 16198951 ↗

References (22)

  1. Reviews

    1

    Vandamme D, et al. (2012). Cell Immunol

    DOI: 10.1016/j.cellimm.2012.11.009PubMed 23246832

  2. 2

    Bucki R, et al. (2010). Arch Immunol Ther Exp (Warsz)

    DOI: 10.1007/s00005-009-0057-2PubMed 20049649

  3. 3

    Durr UHN, Sudheendra US, Ramamoorthy A. (2006). Biochim Biophys Acta

    DOI: 10.1016/j.bbamem.2006.03.030PubMed 16716248

  4. Primary research

    4

    Sancho-Vaello E, et al. (2020). Sci Rep

    DOI: 10.1038/s41598-020-74401-5PubMed 33060695

  5. 5

    Coorens M, et al. (2011). PLoS One

    DOI: 10.1371/journal.pone.0026525PubMed 22028895

  6. 6

    Mookherjee N, et al. (2009). J Immunol

    DOI: 10.4049/jimmunol.0802586PubMed 19605696

  7. 7

    Overhage J, et al. (2008). Infect Immun

    DOI: 10.1128/IAI.00318-08PubMed 18591225

  8. 8

    Wang G. (2008). J Biol Chem

    DOI: 10.1074/jbc.M805533200PubMed 18818205

  9. 9

    Porcelli F, et al. (2008). Biochemistry

    DOI: 10.1021/bi702036sPubMed 18439024

  10. 10

    Sevcsik E, et al. (2007). Biochim Biophys Acta

    DOI: 10.1016/j.bbamem.2007.06.015PubMed 17662236

  11. 11

    Oren Z, et al. (1999). Biochem J

    DOI: 10.1042/bj3410501PubMed 10417317

  12. 12

    Johansson J, et al. (1998). J Biol Chem

    DOI: 10.1074/jbc.273.6.3718PubMed 9452503

  13. 13

    Rosenfeld Y, Papo N, Shai Y. (2006). J Biol Chem

    DOI: 10.1074/jbc.M507337200PubMed 16330465

  14. 14

    Mookherjee N, et al. (2006). J Immunol

    DOI: 10.4049/jimmunol.176.4.2455PubMed 16456005

  15. 15

    Scott MG, et al. (2002). J Immunol

    DOI: 10.4049/jimmunol.169.7.3883PubMed 12244186

  16. 16

    Elssner A, et al. (2004). J Immunol

    DOI: 10.4049/jimmunol.172.8.4987PubMed 15067080

  17. 17

    Henzler-Wildman KA, et al. (2004). Biochemistry

    DOI: 10.1021/bi036284sPubMed 15222757

  18. 18

    Koczulla R, et al. (2003). J Clin Invest

    DOI: 10.1172/JCI17545PubMed 12782669

  19. 19

    Henzler-Wildman KA, Lee DK, Ramamoorthy A. (2003). Biochemistry

    DOI: 10.1021/bi0273563PubMed 12767238

  20. 20

    De Yang, et al. (2000). J Exp Med

    DOI: 10.1084/jem.192.7.1069PubMed 11015447

  21. 21

    Gudmundsson GH, et al. (1996). Eur J Biochem

    DOI: 10.1111/j.1432-1033.1996.0325z.xPubMed 8681941

  22. 22

    Agerberth B, et al. (1995). Proc Natl Acad Sci USA

    DOI: 10.1073/pnas.92.1.195PubMed 7529412